Lineage for d1dlba_ (1dlb A:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3040824Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 3042053Superfamily h.3.2: Virus ectodomain [58069] (2 families) (S)
  5. 3042054Family h.3.2.1: Virus ectodomain [58070] (9 proteins)
  6. 3042100Protein Retrovius gp41 protease-resistant core [58071] (4 species)
    coiled coil; biological unit: trimer
  7. 3042101Species Human immunodeficiency virus type 1 [TaxId:11676] [58072] (26 PDB entries)
  8. 3042124Domain d1dlba_: 1dlb A: [45722]

Details for d1dlba_

PDB Entry: 1dlb (more details), 2 Å

PDB Description: helical interactions in the hiv-1 gp41 core reveals structural basis for the inhibitory activity of gp41 peptides
PDB Compounds: (A:) hiv-1 envelope glycoprotein gp41

SCOPe Domain Sequences for d1dlba_:

Sequence, based on SEQRES records: (download)

>d1dlba_ h.3.2.1 (A:) Retrovius gp41 protease-resistant core {Human immunodeficiency virus type 1 [TaxId: 11676]}
givqqqnnllraieaqqhllqltvwgikqlqarsggrggwmewdreinnytslihsliee
sqnlq

Sequence, based on observed residues (ATOM records): (download)

>d1dlba_ h.3.2.1 (A:) Retrovius gp41 protease-resistant core {Human immunodeficiency virus type 1 [TaxId: 11676]}
givqqqnnllraieaqqhllqltvwgikqlqarsrggwmewdreinnytslihslieesq
nlq

SCOPe Domain Coordinates for d1dlba_:

Click to download the PDB-style file with coordinates for d1dlba_.
(The format of our PDB-style files is described here.)

Timeline for d1dlba_: