Lineage for d1czqa_ (1czq A:)

  1. Root: SCOP 1.61
  2. 205390Class h: Coiled coil proteins [57942] (5 folds)
  3. 205977Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
  4. 206041Superfamily h.3.2: Virus ectodomain [58069] (1 family) (S)
  5. 206042Family h.3.2.1: Virus ectodomain [58070] (6 proteins)
  6. 206077Protein Retrovius gp41 protease-resistant core [58071] (3 species)
  7. 206078Species Human immunodeficiency virus type 1 [TaxId:11676] [58072] (13 PDB entries)
  8. 206080Domain d1czqa_: 1czq A: [45720]

Details for d1czqa_

PDB Entry: 1czq (more details), 1.5 Å

PDB Description: crystal structure of the d10-p1/iqn17 complex: a d-peptide inhibitor of hiv-1 entry bound to the gp41 coiled-coil pocket.

SCOP Domain Sequences for d1czqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1czqa_ h.3.2.1 (A:) Retrovius gp41 protease-resistant core {Human immunodeficiency virus type 1}
rmkqiedkieeieskqkkieneiarikkllqltvwgikqlqaril

SCOP Domain Coordinates for d1czqa_:

Click to download the PDB-style file with coordinates for d1czqa_.
(The format of our PDB-style files is described here.)

Timeline for d1czqa_: