SCOP 1.73: Domain d1df4a_: 1df4 A:

Lineage for d1df4a_ (1df4 A:)

1. Root: SCOP 1.73

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.2: Virus ectodomain [58069] (1 family)

5. Family h.3.2.1: Virus ectodomain [58070] (8 proteins)

6. Protein Retrovius gp41 protease-resistant core [58071] (3 species)
   coiled coil; biological unit: trimer

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [58072] (19 PDB entries)

8. Domain d1df4a_: 1df4 A: [45719]

Details for d1df4a_

PDB Entry: 1df4, 1.45 Å

PDB Description: interactions between hiv-1 gp41 core and detergents and their implications for membrane fusion

PDB Compounds: (A:) hiv-1 envelope glycoprotein gp41

SCOP Domain Sequences for d1df4a_:

Sequence, based on SEQRES records:

>d1df4a_ h.3.2.1 (A:) Retrovius gp41 protease-resistant core {Human immunodeficiency virus type 1 [TaxId: 11676]}
ivqqqnnllraieaqqhllqltvwgikqlqarsggrggwmewdreinnytslihsliees
qn

Sequence, based on observed residues (ATOM records):

>d1df4a_ h.3.2.1 (A:) Retrovius gp41 protease-resistant core {Human immunodeficiency virus type 1 [TaxId: 11676]}
ivqqqnnllraieaqqhllqltvwgikqlqaggwmewdreinnytslihslieesqn

Timeline for d1df4a_:

• d1df4a_ first appeared (with stable ids) in SCOP 1.55
  
• d1df4a_ appears in SCOP 1.71
  
• d1df4a_ appears in SCOP 1.75
  
• d1df4a_ appears in the current release, SCOPe 2.08