Lineage for d1flcf_ (1flc F:)

  1. Root: SCOP 1.55
  2. Class h: Coiled coil proteins [57942] (5 folds)
  3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
  4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (1 family) (S)
  5. Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (1 protein)
  6. Protein Influenza hemagglutinin (stalk) [58066] (2 species)
  7. Species Influenza C virus [TaxId:11552] [58068] (1 PDB entry)
  8. Domain d1flcf_: 1flc F: [45718]
    Other proteins in same PDB: d1flca1, d1flca2, d1flcc1, d1flcc2, d1flce1, d1flce2

Details for d1flcf_

PDB Entry: 1flc (more details), 3.2 Å

PDB Description: x-ray structure of the haemagglutinin-esterase-fusion glycoprotein of influenza c virus

SCOP Domain Sequences for d1flcf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1flcf_ h.3.1.1 (F:) Influenza hemagglutinin (stalk) {Influenza C virus}
iddliigvlfvaivetgiggyllgsrkesgggvtkesaekgfekigndiqilkssiniai
eklndrishdeqairdltleienarseallgelgiirallvgnisiglqeslwelaseit
nragdlavevspgcwiidnnicdqscqnfifkfnetapvpti

SCOP Domain Coordinates for d1flcf_ are not available.

Timeline for d1flcf_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1flca1, d1flca2, d1flcb_, d1flcc1, d1flcc2, d1flcd_, d1flce1, d1flce2