SCOPe 2.07: Domain d1flcb_: 1flc B:

Lineage for d1flcb_ (1flc B:)

1. Root: SCOPe 2.07

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)

6. Protein Influenza hemagglutinin (stalk) [58066] (17 species)
   trimer

7. Species Influenza C virus [TaxId:11552] [58068] (1 PDB entry)

8. Domain d1flcb_: 1flc B: [45716]
   Other proteins in same PDB: d1flca1, d1flca2, d1flcc1, d1flcc2, d1flce1, d1flce2
   complexed with bma, man, nag, ndg

Details for d1flcb_

PDB Entry: 1flc, 3.2 Å

PDB Description: x-ray structure of the haemagglutinin-esterase-fusion glycoprotein of influenza c virus

PDB Compounds: (B:) haemagglutinin-esterase-fusion glycoprotein

SCOPe Domain Sequences for d1flcb_:

Sequence; same for both SEQRES and ATOM records:

>d1flcb_ h.3.1.1 (B:) Influenza hemagglutinin (stalk) {Influenza C virus [TaxId: 11552]}
iddliigvlfvaivetgiggyllgsrkesgggvtkesaekgfekigndiqilkssiniai
eklndrishdeqairdltleienarseallgelgiirallvgnisiglqeslwelaseit
nragdlavevspgcwiidnnicdqscqnfifkfnetapvpti

Timeline for d1flcb_:

• d1flcb_ first appeared (with stable ids) in SCOP 1.55
  
• d1flcb_ appears in SCOPe 2.06
  
• d1flcb_ appears in the current release, SCOPe 2.08