Lineage for d5hmgf_ (5hmg F:)

  1. Root: SCOP 1.71
  2. 625746Class h: Coiled coil proteins [57942] (7 folds)
  3. 626649Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 626650Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (1 family) (S)
  5. 626651Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (1 protein)
  6. 626652Protein Influenza hemagglutinin (stalk) [58066] (2 species)
    trimer
  7. 626653Species Influenza A virus, different strains [TaxId:11320] [58067] (35 PDB entries)
  8. 626738Domain d5hmgf_: 5hmg F: [45715]
    Other proteins in same PDB: d5hmga_, d5hmgc_, d5hmge_
    complexed with man, nag, sia; mutant

Details for d5hmgf_

PDB Entry: 5hmg (more details), 3.2 Å

PDB Description: refinement of the influenza virus hemagglutinin by simulated annealing

SCOP Domain Sequences for d5hmgf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hmgf_ h.3.1.1 (F:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains}
glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektn
ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltgsemnklfe
ktrrqlrenaeemgngcfkiyhkcdnaciesirngtydhdvyrdealnnrfqikg

SCOP Domain Coordinates for d5hmgf_:

Click to download the PDB-style file with coordinates for d5hmgf_.
(The format of our PDB-style files is described here.)

Timeline for d5hmgf_: