Lineage for d5hmgb_ (5hmg B:)

  1. Root: SCOPe 2.02
  2. 1246834Class h: Coiled coil proteins [57942] (7 folds)
  3. 1247941Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 1247942Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (1 family) (S)
  5. 1247943Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (1 protein)
  6. 1247944Protein Influenza hemagglutinin (stalk) [58066] (2 species)
    trimer
  7. 1247945Species Influenza A virus, different strains [TaxId:11320] [58067] (38 PDB entries)
  8. 1248031Domain d5hmgb_: 5hmg B: [45713]
    Other proteins in same PDB: d5hmga_, d5hmgc_, d5hmge_
    complexed with nag, sia

Details for d5hmgb_

PDB Entry: 5hmg (more details), 3.2 Å

PDB Description: refinement of the influenza virus hemagglutinin by simulated annealing
PDB Compounds: (B:) hemagglutinin, ha1 chain

SCOPe Domain Sequences for d5hmgb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hmgb_ h.3.1.1 (B:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektn
ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltgsemnklfe
ktrrqlrenaeemgngcfkiyhkcdnaciesirngtydhdvyrdealnnrfqikg

SCOPe Domain Coordinates for d5hmgb_:

Click to download the PDB-style file with coordinates for d5hmgb_.
(The format of our PDB-style files is described here.)

Timeline for d5hmgb_: