SCOP 1.71: Domain d5hmgb_: 5hmg B:

Lineage for d5hmgb_ (5hmg B:)

1. Root: SCOP 1.71

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (1 family)

5. Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (1 protein)

6. Protein Influenza hemagglutinin (stalk) [58066] (2 species)
   trimer

7. Species Influenza A virus, different strains [TaxId:11320] [58067] (35 PDB entries)

8. Domain d5hmgb_: 5hmg B: [45713]
   Other proteins in same PDB: d5hmga_, d5hmgc_, d5hmge_

Details for d5hmgb_

PDB Entry: 5hmg, 3.2 Å

PDB Description: refinement of the influenza virus hemagglutinin by simulated annealing

SCOP Domain Sequences for d5hmgb_:

Sequence; same for both SEQRES and ATOM records:

>d5hmgb_ h.3.1.1 (B:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains}
glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektn
ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltgsemnklfe
ktrrqlrenaeemgngcfkiyhkcdnaciesirngtydhdvyrdealnnrfqikg

Timeline for d5hmgb_:

• d5hmgb_ first appeared (with stable ids) in SCOP 1.55
  
• d5hmgb_ appears in SCOP 1.69
  
• d5hmgb_ appears in SCOP 1.73
  
• d5hmgb_ appears in the current release, SCOPe 2.08