Lineage for d1hgfd_ (1hgf D:)

  1. Root: SCOPe 2.01
  2. 1067937Class h: Coiled coil proteins [57942] (7 folds)
  3. 1069044Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 1069045Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (1 family) (S)
  5. 1069046Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (1 protein)
  6. 1069047Protein Influenza hemagglutinin (stalk) [58066] (2 species)
    trimer
  7. 1069048Species Influenza A virus, different strains [TaxId:11320] [58067] (38 PDB entries)
  8. 1069126Domain d1hgfd_: 1hgf D: [45711]
    Other proteins in same PDB: d1hgfa_, d1hgfc_, d1hgfe_
    complexed with nag

Details for d1hgfd_

PDB Entry: 1hgf (more details), 3 Å

PDB Description: binding of influenza virus hemagglutinin to analogs of its cell- surface receptor, sialic acid: analysis by proton nuclear magnetic resonance spectroscopy and x-ray crystallography
PDB Compounds: (D:) hemagglutinin, chain ha1

SCOPe Domain Sequences for d1hgfd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hgfd_ h.3.1.1 (D:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektn
ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
ktrrqlrenaeemgngcfkiyhkcdnaciesirngtydhdvyrdealnnrfqikg

SCOPe Domain Coordinates for d1hgfd_:

Click to download the PDB-style file with coordinates for d1hgfd_.
(The format of our PDB-style files is described here.)

Timeline for d1hgfd_: