Lineage for d1hgfb_ (1hgf B:)

  1. Root: SCOP 1.55
  2. Class h: Coiled coil proteins [57942] (5 folds)
  3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
  4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (1 family) (S)
  5. Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (1 protein)
  6. Protein Influenza hemagglutinin (stalk) [58066] (2 species)
  7. Species Influenza A virus, different strains [TaxId:11320] [58067] (17 PDB entries)
  8. Domain d1hgfb_: 1hgf B: [45710]
    Other proteins in same PDB: d1hgfa_, d1hgfc_, d1hgfe_

Details for d1hgfb_

PDB Entry: 1hgf (more details), 3 Å

PDB Description: binding of influenza virus hemagglutinin to analogs of its cell-surface receptor, sialic acid: analysis by proton nuclear magnetic resonance spectroscopy and x-ray crystallography

SCOP Domain Sequences for d1hgfb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hgfb_ h.3.1.1 (B:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains}
glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektn
ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
ktrrqlrenaeemgngcfkiyhkcdnaciesirngtydhdvyrdealnnrfqikg

SCOP Domain Coordinates for d1hgfb_ are not available.

Timeline for d1hgfb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1hgfa_, d1hgfc_, d1hgfd_, d1hgfe_, d1hgff_