| Class h: Coiled coil proteins [57942] (7 folds) |
| Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) ![]() |
| Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins) |
| Protein Influenza hemagglutinin (stalk) [58066] (17 species) trimer |
| Species Influenza A virus, different strains [TaxId:11320] [58067] (131 PDB entries) |
| Domain d4hmgd_: 4hmg D: [45708] Other proteins in same PDB: d4hmga_, d4hmgc_, d4hmge_ complexed with nag, sia |
PDB Entry: 4hmg (more details), 3 Å
SCOPe Domain Sequences for d4hmgd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hmgd_ h.3.1.1 (D:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektn
ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
ktrrqlrenaeemgngcfkiyhkcdnaciesirngtydhdvyrdealnnrfqikg
Timeline for d4hmgd_: