SCOP 1.75: Domain d4hmgb_: 4hmg B:

Lineage for d4hmgb_ (4hmg B:)

1. Root: SCOP 1.75

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (1 family)

5. Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (1 protein)

6. Protein Influenza hemagglutinin (stalk) [58066] (2 species)
   trimer

7. Species Influenza A virus, different strains [TaxId:11320] [58067] (38 PDB entries)

8. Domain d4hmgb_: 4hmg B: [45707]
   Other proteins in same PDB: d4hmga_, d4hmgc_, d4hmge_

Details for d4hmgb_

PDB Entry: 4hmg, 3 Å

PDB Description: refinement of the influenza virus hemagglutinin by simulated annealing

PDB Compounds: (B:) hemagglutinin, chain ha1

SCOP Domain Sequences for d4hmgb_:

Sequence; same for both SEQRES and ATOM records:

>d4hmgb_ h.3.1.1 (B:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektn
ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
ktrrqlrenaeemgngcfkiyhkcdnaciesirngtydhdvyrdealnnrfqikg

Timeline for d4hmgb_:

• d4hmgb_ first appeared (with stable ids) in SCOP 1.55
  
• d4hmgb_ appears in SCOP 1.73
  
• d4hmgb_ appears in SCOPe 2.01
  
• d4hmgb_ appears in the current release, SCOPe 2.08