SCOP 1.73: Domain d3hmgf_: 3hmg F:

Lineage for d3hmgf_ (3hmg F:)

1. Root: SCOP 1.73

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (1 family)

5. Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (1 protein)

6. Protein Influenza hemagglutinin (stalk) [58066] (2 species)
   trimer

7. Species Influenza A virus, different strains [TaxId:11320] [58067] (38 PDB entries)

8. Domain d3hmgf_: 3hmg F: [45706]
   Other proteins in same PDB: d3hmga_, d3hmgc_, d3hmge_
   complexed with man, nag; mutant

Details for d3hmgf_

PDB Entry: 3hmg, 2.9 Å

PDB Description: refinement of the influenza virus hemagglutinin by simulated annealing

PDB Compounds: (F:) Hemagglutinin

SCOP Domain Sequences for d3hmgf_:

Sequence; same for both SEQRES and ATOM records:

>d3hmgf_ h.3.1.1 (F:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektn
ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
ktrrqlrenaeemgngcfkiyhkcdnaciesirngtydhdvyrdealnnrfqikg

Timeline for d3hmgf_:

• d3hmgf_ first appeared (with stable ids) in SCOP 1.55
  
• d3hmgf_ appears in SCOP 1.71
  
• d3hmgf_ appears in SCOP 1.75
  
• d3hmgf_ appears in the current release, SCOPe 2.08