Lineage for d3hmgd_ (3hmg D:)

  1. Root: SCOPe 2.03
  2. 1466120Class h: Coiled coil proteins [57942] (7 folds)
  3. 1467291Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 1467292Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (1 family) (S)
  5. 1467293Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (1 protein)
  6. 1467294Protein Influenza hemagglutinin (stalk) [58066] (2 species)
    trimer
  7. 1467295Species Influenza A virus, different strains [TaxId:11320] [58067] (45 PDB entries)
  8. 1467370Domain d3hmgd_: 3hmg D: [45705]
    Other proteins in same PDB: d3hmga_, d3hmgc_, d3hmge_
    complexed with nag

Details for d3hmgd_

PDB Entry: 3hmg (more details), 2.9 Å

PDB Description: refinement of the influenza virus hemagglutinin by simulated annealing
PDB Compounds: (D:) Hemagglutinin

SCOPe Domain Sequences for d3hmgd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hmgd_ h.3.1.1 (D:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektn
ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
ktrrqlrenaeemgngcfkiyhkcdnaciesirngtydhdvyrdealnnrfqikg

SCOPe Domain Coordinates for d3hmgd_:

Click to download the PDB-style file with coordinates for d3hmgd_.
(The format of our PDB-style files is described here.)

Timeline for d3hmgd_: