SCOP 1.65: Domain d3hmgb_: 3hmg B:

Lineage for d3hmgb_ (3hmg B:)

1. Root: SCOP 1.65

2. Class h: Coiled coil proteins [57942] (6 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (2 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (1 family)

5. Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (1 protein)

6. Protein Influenza hemagglutinin (stalk) [58066] (2 species)
   trimer

7. Species Influenza A virus, different strains [TaxId:11320] [58067] (24 PDB entries)

8. Domain d3hmgb_: 3hmg B: [45704]
   Other proteins in same PDB: d3hmga_, d3hmgc_, d3hmge_

Details for d3hmgb_

PDB Entry: 3hmg, 2.9 Å

PDB Description: refinement of the influenza virus hemagglutinin by simulated annealing

SCOP Domain Sequences for d3hmgb_:

Sequence; same for both SEQRES and ATOM records:

>d3hmgb_ h.3.1.1 (B:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains}
glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektn
ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
ktrrqlrenaeemgngcfkiyhkcdnaciesirngtydhdvyrdealnnrfqikg

Timeline for d3hmgb_:

• d3hmgb_ first appeared (with stable ids) in SCOP 1.55
  
• d3hmgb_ appears in SCOP 1.63
  
• d3hmgb_ appears in SCOP 1.67
  
• d3hmgb_ appears in the current release, SCOPe 2.08