Lineage for d2hmgf_ (2hmg F:)

  1. Root: SCOP 1.55
  2. Class h: Coiled coil proteins [57942] (5 folds)
  3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
  4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (1 family) (S)
  5. Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (1 protein)
  6. Protein Influenza hemagglutinin (stalk) [58066] (2 species)
  7. Species Influenza A virus, different strains [TaxId:11320] [58067] (17 PDB entries)
  8. Domain d2hmgf_: 2hmg F: [45703]
    Other proteins in same PDB: d2hmga_, d2hmgc_, d2hmge_

Details for d2hmgf_

PDB Entry: 2hmg (more details), 3 Å

PDB Description: refinement of the influenza virus hemagglutinin by simulated annealing

SCOP Domain Sequences for d2hmgf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hmgf_ h.3.1.1 (F:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains}
glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektn
ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
ktrrqlrenaeemgngcfkiyhkcdnaciesirngtydhdvyrdealnnrfqikg

SCOP Domain Coordinates for d2hmgf_ are not available.

Timeline for d2hmgf_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2hmga_, d2hmgb_, d2hmgc_, d2hmgd_, d2hmge_