SCOP 1.75: Domain d1hggf_: 1hgg F:

Lineage for d1hggf_ (1hgg F:)

1. Root: SCOP 1.75

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (1 family)

5. Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (1 protein)

6. Protein Influenza hemagglutinin (stalk) [58066] (2 species)
   trimer

7. Species Influenza A virus, different strains [TaxId:11320] [58067] (38 PDB entries)

8. Domain d1hggf_: 1hgg F: [45700]
   Other proteins in same PDB: d1hgga_, d1hggc_, d1hgge_
   complexed with gal, glc, man, nag, nan

Details for d1hggf_

PDB Entry: 1hgg, 2.9 Å

PDB Description: binding of influenza virus hemagglutinin to analogs of its cell- surface receptor, sialic acid: analysis by proton nuclear magnetic resonance spectroscopy and x-ray crystallography

PDB Compounds: (F:) hemagglutinin, chain ha2

SCOP Domain Sequences for d1hggf_:

Sequence; same for both SEQRES and ATOM records:

>d1hggf_ h.3.1.1 (F:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektn
ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
ktrrqlrenaeemgngcfkiyhkcdnaciesirngtydhdvyrdealnnrfqikg

Timeline for d1hggf_:

• d1hggf_ first appeared (with stable ids) in SCOP 1.55
  
• d1hggf_ appears in SCOP 1.73
  
• d1hggf_ appears in SCOPe 2.01
  
• d1hggf_ appears in the current release, SCOPe 2.08