Lineage for d1hggd_ (1hgg D:)

  1. Root: SCOPe 2.07
  2. 2590057Class h: Coiled coil proteins [57942] (7 folds)
  3. 2591558Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2591559Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2591560Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 protein domains)
  6. 2591561Protein Influenza hemagglutinin (stalk) [58066] (13 species)
    trimer
  7. 2591653Species Influenza A virus, different strains [TaxId:11320] [58067] (125 PDB entries)
  8. 2591823Domain d1hggd_: 1hgg D: [45699]
    Other proteins in same PDB: d1hgga_, d1hggc_, d1hgge_
    complexed with nag

Details for d1hggd_

PDB Entry: 1hgg (more details), 2.9 Å

PDB Description: binding of influenza virus hemagglutinin to analogs of its cell-surface receptor, sialic acid: analysis by proton nuclear magnetic resonance spectroscopy and x-ray crystallography
PDB Compounds: (D:) hemagglutinin, chain ha2

SCOPe Domain Sequences for d1hggd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hggd_ h.3.1.1 (D:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektn
ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
ktrrqlrenaeemgngcfkiyhkcdnaciesirngtydhdvyrdealnnrfqikg

SCOPe Domain Coordinates for d1hggd_:

Click to download the PDB-style file with coordinates for d1hggd_.
(The format of our PDB-style files is described here.)

Timeline for d1hggd_: