SCOP 1.55: Domain d1hggb_: 1hgg B:

Lineage for d1hggb_ (1hgg B:)

1. Root: SCOP 1.55
2. Class h: Coiled coil proteins [57942] (5 folds)
3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (1 family)
5. Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (1 protein)
6. Protein Influenza hemagglutinin (stalk) [58066] (2 species)
7. Species Influenza A virus, different strains [TaxId:11320] [58067] (17 PDB entries)
8. Domain d1hggb_: 1hgg B: [45698]
   Other proteins in same PDB: d1hgga_, d1hggc_, d1hgge_

Details for d1hggb_

PDB Entry: 1hgg, 2.9 Å

PDB Description: binding of influenza virus hemagglutinin to analogs of its cell- surface receptor, sialic acid: analysis by proton nuclear magnetic resonance spectroscopy and x-ray crystallography

SCOP Domain Sequences for d1hggb_:

Sequence; same for both SEQRES and ATOM records:

>d1hggb_ h.3.1.1 (B:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains}
glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektn
ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
ktrrqlrenaeemgngcfkiyhkcdnaciesirngtydhdvyrdealnnrfqikg

SCOP Domain Coordinates for d1hggb_ are not available.

Timeline for d1hggb_:

• d1hggb_ appears in SCOP 1.57
  
• d1hggb_ appears in the current release, SCOPe 2.08