SCOPe 2.05: Domain d1hghf_: 1hgh F:

Lineage for d1hghf_ (1hgh F:)

1. Root: SCOPe 2.05

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)

6. Protein Influenza hemagglutinin (stalk) [58066] (8 species)
   trimer

7. Species Influenza A virus, different strains [TaxId:11320] [58067] (109 PDB entries)

8. Domain d1hghf_: 1hgh F: [45696]
   Other proteins in same PDB: d1hgha_, d1hghc_, d1hghe_
   complexed with mna, nag

Details for d1hghf_

PDB Entry: 1hgh, 2.7 Å

PDB Description: binding of influenza virus hemagglutinin to analogs of its cell- surface receptor, sialic acid: analysis by proton nuclear magnetic resonance spectroscopy and x-ray crystallography

PDB Compounds: (F:) hemagglutinin, chain ha1

SCOPe Domain Sequences for d1hghf_:

Sequence; same for both SEQRES and ATOM records:

>d1hghf_ h.3.1.1 (F:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektn
ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
ktrrqlrenaeemgngcfkiyhkcdnaciesirngtydhdvyrdealnnrfqikg

Timeline for d1hghf_:

• d1hghf_ first appeared (with stable ids) in SCOP 1.55
  
• d1hghf_ appears in SCOPe 2.04
  
• d1hghf_ appears in SCOPe 2.06
  
• d1hghf_ appears in the current release, SCOPe 2.08