Lineage for d1hgdb_ (1hgd B:)

  1. Root: SCOPe 2.05
  2. 1968223Class h: Coiled coil proteins [57942] (7 folds)
  3. 1969577Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 1969578Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 1969579Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 1969580Protein Influenza hemagglutinin (stalk) [58066] (8 species)
    trimer
  7. 1969596Species Influenza A virus, different strains [TaxId:11320] [58067] (109 PDB entries)
  8. 1969709Domain d1hgdb_: 1hgd B: [45691]
    Other proteins in same PDB: d1hgda_, d1hgdc_, d1hgde_
    complexed with nag

Details for d1hgdb_

PDB Entry: 1hgd (more details), 2.7 Å

PDB Description: binding of influenza virus hemagglutinin to analogs of its cell-surface receptor, sialic acid: analysis by proton nuclear magnetic resonance spectroscopy and x-ray crystallography
PDB Compounds: (B:) hemagglutinin, chain ha1

SCOPe Domain Sequences for d1hgdb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hgdb_ h.3.1.1 (B:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektn
ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
ktrrqlrenaeemgngcfkiyhkcdnaciesirngtydhdvyrdealnnrfqikg

SCOPe Domain Coordinates for d1hgdb_:

Click to download the PDB-style file with coordinates for d1hgdb_.
(The format of our PDB-style files is described here.)

Timeline for d1hgdb_: