SCOP 1.69: Domain d1hgdb_: 1hgd B:

Lineage for d1hgdb_ (1hgd B:)

1. Root: SCOP 1.69

2. Class h: Coiled coil proteins [57942] (6 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (1 family)

5. Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (1 protein)

6. Protein Influenza hemagglutinin (stalk) [58066] (2 species)
   trimer

7. Species Influenza A virus, different strains [TaxId:11320] [58067] (35 PDB entries)

8. Domain d1hgdb_: 1hgd B: [45691]
   Other proteins in same PDB: d1hgda_, d1hgdc_, d1hgde_

Details for d1hgdb_

PDB Entry: 1hgd, 2.7 Å

PDB Description: binding of influenza virus hemagglutinin to analogs of its cell- surface receptor, sialic acid: analysis by proton nuclear magnetic resonance spectroscopy and x-ray crystallography

SCOP Domain Sequences for d1hgdb_:

Sequence; same for both SEQRES and ATOM records:

>d1hgdb_ h.3.1.1 (B:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains}
glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektn
ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
ktrrqlrenaeemgngcfkiyhkcdnaciesirngtydhdvyrdealnnrfqikg

Timeline for d1hgdb_:

• d1hgdb_ first appeared (with stable ids) in SCOP 1.55
  
• d1hgdb_ appears in SCOP 1.67
  
• d1hgdb_ appears in SCOP 1.71
  
• d1hgdb_ appears in the current release, SCOPe 2.08