Lineage for d1qfub_ (1qfu B:)

  1. Root: SCOP 1.75
  2. 894739Class h: Coiled coil proteins [57942] (7 folds)
  3. 895846Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 895847Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (1 family) (S)
  5. 895848Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (1 protein)
  6. 895849Protein Influenza hemagglutinin (stalk) [58066] (2 species)
    trimer
  7. 895850Species Influenza A virus, different strains [TaxId:11320] [58067] (38 PDB entries)
  8. 895911Domain d1qfub_: 1qfu B: [45689]
    Other proteins in same PDB: d1qfua_, d1qfuh1, d1qfuh2, d1qful1, d1qful2
    complexed with man, nag

Details for d1qfub_

PDB Entry: 1qfu (more details), 2.8 Å

PDB Description: influenza virus hemagglutinin complexed with a neutralizing antibody
PDB Compounds: (B:) protein (hemagglutinin (ha2 chain))

SCOP Domain Sequences for d1qfub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qfub_ h.3.1.1 (B:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektn
ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
ktrrqlrenaeemgngcfkiyhkcdnaciesirngtydhdvyrdealnnrfqik

SCOP Domain Coordinates for d1qfub_:

Click to download the PDB-style file with coordinates for d1qfub_.
(The format of our PDB-style files is described here.)

Timeline for d1qfub_: