SCOP 1.63: Domain d1qfub_: 1qfu B:

Lineage for d1qfub_ (1qfu B:)

1. Root: SCOP 1.63

2. Class h: Coiled coil proteins [57942] (6 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (1 family)

5. Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (1 protein)

6. Protein Influenza hemagglutinin (stalk) [58066] (2 species)
   trimer

7. Species Influenza A virus, different strains [TaxId:11320] [58067] (24 PDB entries)

8. Domain d1qfub_: 1qfu B: [45689]
   Other proteins in same PDB: d1qfua_, d1qfuh1, d1qfuh2, d1qful1, d1qful2
   complexed with man, nag

Details for d1qfub_

PDB Entry: 1qfu, 2.8 Å

PDB Description: influenza virus hemagglutinin complexed with a neutralizing antibody

SCOP Domain Sequences for d1qfub_:

Sequence; same for both SEQRES and ATOM records:

>d1qfub_ h.3.1.1 (B:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains}
glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektn
ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
ktrrqlrenaeemgngcfkiyhkcdnaciesirngtydhdvyrdealnnrfqik

Timeline for d1qfub_:

• d1qfub_ first appeared (with stable ids) in SCOP 1.55
  
• d1qfub_ appears in SCOP 1.61
  
• d1qfub_ appears in SCOP 1.65
  
• d1qfub_ appears in the current release, SCOPe 2.08