SCOPe 2.03: Domain d1hgjb_: 1hgj B:

Lineage for d1hgjb_ (1hgj B:)

1. Root: SCOPe 2.03

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (1 family)

5. Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (1 protein)

6. Protein Influenza hemagglutinin (stalk) [58066] (2 species)
   trimer

7. Species Influenza A virus, different strains [TaxId:11320] [58067] (45 PDB entries)

8. Domain d1hgjb_: 1hgj B: [45686]
   Other proteins in same PDB: d1hgja_, d1hgjc_, d1hgje_
   complexed with amn, nag

Details for d1hgjb_

PDB Entry: 1hgj, 2.7 Å

PDB Description: binding of influenza virus hemagglutinin to analogs of its cell- surface receptor, sialic acid: analysis by proton nuclear magnetic resonance spectroscopy and x-ray crystallography

PDB Compounds: (B:) hemagglutinin, chain ha1

SCOPe Domain Sequences for d1hgjb_:

Sequence; same for both SEQRES and ATOM records:

>d1hgjb_ h.3.1.1 (B:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektn
ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
ktrrqlrenaeemgngcfkiyhkcdnaciesirngtydhdvyrdealnnrfqikg

Timeline for d1hgjb_:

• d1hgjb_ first appeared (with stable ids) in SCOP 1.55
  
• d1hgjb_ appears in SCOPe 2.02
  
• d1hgjb_ appears in SCOPe 2.04
  
• d1hgjb_ appears in the current release, SCOPe 2.08