SCOP 1.55: Domain d1hgjb_: 1hgj B:

Lineage for d1hgjb_ (1hgj B:)

1. Root: SCOP 1.55
2. Class h: Coiled coil proteins [57942] (5 folds)
3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (1 family)
5. Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (1 protein)
6. Protein Influenza hemagglutinin (stalk) [58066] (2 species)
7. Species Influenza A virus, different strains [TaxId:11320] [58067] (17 PDB entries)
8. Domain d1hgjb_: 1hgj B: [45686]
   Other proteins in same PDB: d1hgja_, d1hgjc_, d1hgje_

Details for d1hgjb_

PDB Entry: 1hgj, 2.7 Å

PDB Description: binding of influenza virus hemagglutinin to analogs of its cell- surface receptor, sialic acid: analysis by proton nuclear magnetic resonance spectroscopy and x-ray crystallography

SCOP Domain Sequences for d1hgjb_:

Sequence; same for both SEQRES and ATOM records:

>d1hgjb_ h.3.1.1 (B:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains}
glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektn
ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
ktrrqlrenaeemgngcfkiyhkcdnaciesirngtydhdvyrdealnnrfqikg

SCOP Domain Coordinates for d1hgjb_ are not available.

Timeline for d1hgjb_:

• d1hgjb_ appears in SCOP 1.57
  
• d1hgjb_ appears in the current release, SCOPe 2.08