SCOP 1.71: Domain d1hgif_: 1hgi F:

Lineage for d1hgif_ (1hgi F:)

1. Root: SCOP 1.71

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (1 family)

5. Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (1 protein)

6. Protein Influenza hemagglutinin (stalk) [58066] (2 species)
   trimer

7. Species Influenza A virus, different strains [TaxId:11320] [58067] (35 PDB entries)

8. Domain d1hgif_: 1hgi F: [45685]
   Other proteins in same PDB: d1hgia_, d1hgic_, d1hgie_
   complexed with ana, man, nag

Details for d1hgif_

PDB Entry: 1hgi, 2.7 Å

PDB Description: binding of influenza virus hemagglutinin to analogs of its cell- surface receptor, sialic acid: analysis by proton nuclear magnetic resonance spectroscopy and x-ray crystallography

SCOP Domain Sequences for d1hgif_:

Sequence; same for both SEQRES and ATOM records:

>d1hgif_ h.3.1.1 (F:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains}
glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektn
ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
ktrrqlrenaeemgngcfkiyhkcdnaciesirngtydhdvyrdealnnrfqikg

Timeline for d1hgif_:

• d1hgif_ first appeared (with stable ids) in SCOP 1.55
  
• d1hgif_ appears in SCOP 1.69
  
• d1hgif_ appears in SCOP 1.73
  
• d1hgif_ appears in the current release, SCOPe 2.08