Lineage for d1hgib_ (1hgi B:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3040824Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 3040825Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 3040826Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 3040827Protein Influenza hemagglutinin (stalk) [58066] (22 species)
    trimer
  7. 3041028Species Influenza A virus, different strains [TaxId:11320] [58067] (150 PDB entries)
  8. 3041233Domain d1hgib_: 1hgi B: [45683]
    Other proteins in same PDB: d1hgia_, d1hgic_, d1hgie_
    complexed with ana, nag

Details for d1hgib_

PDB Entry: 1hgi (more details), 2.7 Å

PDB Description: binding of influenza virus hemagglutinin to analogs of its cell- surface receptor, sialic acid: analysis by proton nuclear magnetic resonance spectroscopy and x-ray crystallography
PDB Compounds: (B:) hemagglutinin, chain ha1

SCOPe Domain Sequences for d1hgib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hgib_ h.3.1.1 (B:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektn
ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
ktrrqlrenaeemgngcfkiyhkcdnaciesirngtydhdvyrdealnnrfqikg

SCOPe Domain Coordinates for d1hgib_:

Click to download the PDB-style file with coordinates for d1hgib_.
(The format of our PDB-style files is described here.)

Timeline for d1hgib_: