SCOPe 2.06: Domain d1hged_: 1hge D:

Lineage for d1hged_ (1hge D:)

1. Root: SCOPe 2.06

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)

6. Protein Influenza hemagglutinin (stalk) [58066] (12 species)
   trimer

7. Species Influenza A virus, different strains [TaxId:11320] [58067] (127 PDB entries)

8. Domain d1hged_: 1hge D: [45681]
   Other proteins in same PDB: d1hgea_, d1hgec_, d1hgee_
   complexed with mna, nag

Details for d1hged_

PDB Entry: 1hge, 2.6 Å

PDB Description: binding of influenza virus hemagglutinin to analogs of its cell- surface receptor, sialic acid: analysis by proton nuclear magnetic resonance spectroscopy and x-ray crystallography

PDB Compounds: (D:) hemagglutinin, (g135r), ha1 chain

SCOPe Domain Sequences for d1hged_:

Sequence; same for both SEQRES and ATOM records:

>d1hged_ h.3.1.1 (D:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektn
ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
ktrrqlrenaeemgngcfkiyhkcdnaciesirngtydhdvyrdealnnrfqikg

Timeline for d1hged_:

• d1hged_ first appeared (with stable ids) in SCOP 1.55
  
• d1hged_ appears in SCOPe 2.05
  
• d1hged_ appears in SCOPe 2.07
  
• d1hged_ appears in the current release, SCOPe 2.08