Lineage for d1htmf_ (1htm F:)

  1. Root: SCOP 1.55
  2. Class h: Coiled coil proteins [57942] (5 folds)
  3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
  4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (1 family) (S)
  5. Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (1 protein)
  6. Protein Influenza hemagglutinin (stalk) [58066] (2 species)
  7. Species Influenza A virus, different strains [TaxId:11320] [58067] (17 PDB entries)
  8. Domain d1htmf_: 1htm F: [45679]

Details for d1htmf_

PDB Entry: 1htm (more details), 2.5 Å

PDB Description: structure of influenza haemagglutinin at the ph of membrane fusion

SCOP Domain Sequences for d1htmf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1htmf_ h.3.1.1 (F:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains}
stqaaidqingklnrviektnekfhqiekefsevegriqdlekyvedtkidlwsynaell
valenqhtidltdsemnklfektrrqlrenaeemgngcfkiyhkcdnaciesirngtydh
dvy

SCOP Domain Coordinates for d1htmf_ are not available.

Timeline for d1htmf_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1htmb_, d1htmd_