Lineage for d1htmd_ (1htm D:)

  1. Root: SCOPe 2.07
  2. 2590057Class h: Coiled coil proteins [57942] (7 folds)
  3. 2591558Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2591559Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2591560Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 2591561Protein Influenza hemagglutinin (stalk) [58066] (14 species)
    trimer
  7. 2591653Species Influenza A virus, different strains [TaxId:11320] [58067] (127 PDB entries)
  8. 2591706Domain d1htmd_: 1htm D: [45678]
    low pH conformer

Details for d1htmd_

PDB Entry: 1htm (more details), 2.5 Å

PDB Description: structure of influenza haemagglutinin at the ph of membrane fusion
PDB Compounds: (D:) Hemagglutinin HA2 chain

SCOPe Domain Sequences for d1htmd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1htmd_ h.3.1.1 (D:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
stqaaidqingklnrviektnekfhqiekefsevegriqdlekyvedtkidlwsynaell
valenqhtidltdsemnklfektrrqlrenaeemgngcfkiyhkcdnaciesirngtydh
dvy

SCOPe Domain Coordinates for d1htmd_:

Click to download the PDB-style file with coordinates for d1htmd_.
(The format of our PDB-style files is described here.)

Timeline for d1htmd_: