SCOPe 2.04: Domain d1htmb_: 1htm B:

Lineage for d1htmb_ (1htm B:)

1. Root: SCOPe 2.04

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)

6. Protein Influenza hemagglutinin (stalk) [58066] (7 species)
   trimer

7. Species Influenza A virus, different strains [TaxId:11320] [58067] (95 PDB entries)

8. Domain d1htmb_: 1htm B: [45677]
   low pH conformer

Details for d1htmb_

PDB Entry: 1htm, 2.5 Å

PDB Description: structure of influenza haemagglutinin at the ph of membrane fusion

PDB Compounds: (B:) Hemagglutinin HA2 chain

SCOPe Domain Sequences for d1htmb_:

Sequence; same for both SEQRES and ATOM records:

>d1htmb_ h.3.1.1 (B:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
stqaaidqingklnrviektnekfhqiekefsevegriqdlekyvedtkidlwsynaell
valenqhtidltdsemnklfektrrqlrenaeemgngcfkiyhkcdnaciesir

Timeline for d1htmb_:

• d1htmb_ first appeared (with stable ids) in SCOP 1.55
  
• d1htmb_ appears in SCOPe 2.03
  
• d1htmb_ appears in SCOPe 2.05
  
• d1htmb_ appears in the current release, SCOPe 2.08