Lineage for d2viub_ (2viu B:)

  1. Root: SCOP 1.71
  2. 625746Class h: Coiled coil proteins [57942] (7 folds)
  3. 626649Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 626650Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (1 family) (S)
  5. 626651Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (1 protein)
  6. 626652Protein Influenza hemagglutinin (stalk) [58066] (2 species)
    trimer
  7. 626653Species Influenza A virus, different strains [TaxId:11320] [58067] (35 PDB entries)
  8. 626677Domain d2viub_: 2viu B: [45676]
    Other proteins in same PDB: d2viua_
    complexed with man, nag; mutant

Details for d2viub_

PDB Entry: 2viu (more details), 2.5 Å

PDB Description: influenza virus hemagglutinin

SCOP Domain Sequences for d2viub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2viub_ h.3.1.1 (B:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains}
glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektn
ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
ktrrqlrenaeemgngcfkiyhkcdnaciesirngtydhdvyrdealnnrfqikg

SCOP Domain Coordinates for d2viub_:

Click to download the PDB-style file with coordinates for d2viub_.
(The format of our PDB-style files is described here.)

Timeline for d2viub_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2viua_