SCOP 1.65: Domain d1qu1e_: 1qu1 E:

Lineage for d1qu1e_ (1qu1 E:)

1. Root: SCOP 1.65

2. Class h: Coiled coil proteins [57942] (6 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (2 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (1 family)

5. Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (1 protein)

6. Protein Influenza hemagglutinin (stalk) [58066] (2 species)
   trimer

7. Species Influenza A virus, different strains [TaxId:11320] [58067] (24 PDB entries)

8. Domain d1qu1e_: 1qu1 E: [45674]

Details for d1qu1e_

PDB Entry: 1qu1, 1.9 Å

PDB Description: crystal structure of eha2 (23-185)

SCOP Domain Sequences for d1qu1e_:

Sequence; same for both SEQRES and ATOM records:

>d1qu1e_ h.3.1.1 (E:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains}
gqaadlkstqaaidqingklnrviektnekfhqiekefsevegriqdlekyvedtkidlw
synaellvalenqhtidltdsemnklfektrrqlrenaeemgngsfkiyhkcdnaciesi
rngtydhdvyrdealnnrfqikgvel

Timeline for d1qu1e_:

• d1qu1e_ first appeared (with stable ids) in SCOP 1.55
  
• d1qu1e_ appears in SCOP 1.63
  
• d1qu1e_ appears in SCOP 1.67
  
• d1qu1e_ appears in the current release, SCOPe 2.08