Lineage for d1qu1b_ (1qu1 B:)

  1. Root: SCOP 1.73
  2. 752207Class h: Coiled coil proteins [57942] (7 folds)
  3. 753258Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 753259Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (1 family) (S)
  5. 753260Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (1 protein)
  6. 753261Protein Influenza hemagglutinin (stalk) [58066] (2 species)
    trimer
  7. 753262Species Influenza A virus, different strains [TaxId:11320] [58067] (38 PDB entries)
  8. 753265Domain d1qu1b_: 1qu1 B: [45671]

Details for d1qu1b_

PDB Entry: 1qu1 (more details), 1.9 Å

PDB Description: crystal structure of eha2 (23-185)
PDB Compounds: (B:) protein (influenza recombinant ha2 chain)

SCOP Domain Sequences for d1qu1b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qu1b_ h.3.1.1 (B:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
gqaadlkstqaaidqingklnrviektnekfhqiekefsevegriqdlekyvedtkidlw
synaellvalenqhtidltdsemnklfektrrqlrenaeemgngsfkiyhkcdnaciesi
rngtydhdvyrdealnnrfqikgv

SCOP Domain Coordinates for d1qu1b_:

Click to download the PDB-style file with coordinates for d1qu1b_.
(The format of our PDB-style files is described here.)

Timeline for d1qu1b_: