Lineage for d1qu1a_ (1qu1 A:)

  1. Root: SCOP 1.57
  2. Class h: Coiled coil proteins [57942] (5 folds)
  3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
  4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (1 family) (S)
  5. Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (1 protein)
  6. Protein Influenza hemagglutinin (stalk) [58066] (2 species)
  7. Species Influenza A virus, different strains [TaxId:11320] [58067] (23 PDB entries)
  8. Domain d1qu1a_: 1qu1 A: [45670]

Details for d1qu1a_

PDB Entry: 1qu1 (more details), 1.9 Å

PDB Description: crystal structure of eha2 (23-185)

SCOP Domain Sequences for d1qu1a_:

Sequence, based on SEQRES records: (download)

>d1qu1a_ h.3.1.1 (A:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains}
qaadlkstqaaidqingklnrviektnekfhqiekefsevegriqdlekyvedtkidlws
ynaellvalenqhtidltdsemnklfektrrqlrenaeemgngsfkiyhkcdnaciesir
ngtydhdvyrdealnnrfqikg

Sequence, based on observed residues (ATOM records): (download)

>d1qu1a_ h.3.1.1 (A:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains}
qaadlkstqaaidqingklnrviektnekfhqiekefsevegriqdlekyvedtkidlws
ynaellvalenqhtidltdsemnklfektrrqlgsfkiyhkcdnaciesirngtydhdvy
rdealnnrfqikg

SCOP Domain Coordinates for d1qu1a_ are not available.

Timeline for d1qu1a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1qu1b_, d1qu1c_, d1qu1d_, d1qu1e_, d1qu1f_