Lineage for d1qeyd_ (1qey D:)

  1. Root: SCOP 1.55
  2. Class h: Coiled coil proteins [57942] (5 folds)
  3. Fold h.2: Tetramerization domain of the Mnt repressor [58058] (1 superfamily)
  4. Superfamily h.2.1: Tetramerization domain of the Mnt repressor [58059] (1 family) (S)
  5. Family h.2.1.1: Tetramerization domain of the Mnt repressor [58060] (1 protein)
  6. Protein Tetramerization domain of the Mnt repressor [58061] (1 species)
  7. Species Salmonella bacteriophage p22 [TaxId:10754] [58062] (1 PDB entry)
  8. Domain d1qeyd_: 1qey D: [45669]

Details for d1qeyd_

PDB Entry: 1qey (more details)

PDB Description: nmr structure determination of the tetramerization domain of the mnt repressor: an asymmetric a-helical assembly in slow exchange

SCOP Domain Sequences for d1qeyd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qeyd_ h.2.1.1 (D:) Tetramerization domain of the Mnt repressor {Salmonella bacteriophage p22}
rndaerladeqselvkkmvfdtlkdlykktt

SCOP Domain Coordinates for d1qeyd_ are not available.

Timeline for d1qeyd_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1qeya_, d1qeyb_, d1qeyc_