SCOP 1.57: Domain d1qeyc_: 1qey C:

Lineage for d1qeyc_ (1qey C:)

1. Root: SCOP 1.57
2. Class h: Coiled coil proteins [57942] (5 folds)
3. Fold h.2: Tetramerization domain of the Mnt repressor [58058] (1 superfamily)
4. Superfamily h.2.1: Tetramerization domain of the Mnt repressor [58059] (1 family)
5. Family h.2.1.1: Tetramerization domain of the Mnt repressor [58060] (1 protein)
6. Protein Tetramerization domain of the Mnt repressor [58061] (1 species)
7. Species Salmonella bacteriophage p22 [TaxId:10754] [58062] (1 PDB entry)
8. Domain d1qeyc_: 1qey C: [45668]

Details for d1qeyc_

PDB Entry: 1qey

PDB Description: nmr structure determination of the tetramerization domain of the mnt repressor: an asymmetric a-helical assembly in slow exchange

SCOP Domain Sequences for d1qeyc_:

Sequence; same for both SEQRES and ATOM records:

>d1qeyc_ h.2.1.1 (C:) Tetramerization domain of the Mnt repressor {Salmonella bacteriophage p22}
rndaerladeqselvkkmvfdtlkdlykktt

SCOP Domain Coordinates for d1qeyc_ are not available.

Timeline for d1qeyc_:

• d1qeyc_ first appeared (with stable ids) in SCOP 1.55
  
• d1qeyc_ appears in SCOP 1.59
  
• d1qeyc_ appears in the current release, SCOPe 2.08