Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.2: Tetramerization domain of the Mnt repressor [58058] (1 superfamily) |
Superfamily h.2.1: Tetramerization domain of the Mnt repressor [58059] (1 family) tetrameric antiparallel bundle with a right-handed twist |
Family h.2.1.1: Tetramerization domain of the Mnt repressor [58060] (1 protein) |
Protein Tetramerization domain of the Mnt repressor [58061] (1 species) |
Species Salmonella bacteriophage P22 [TaxId:10754] [58062] (1 PDB entry) |
Domain d1qeyc_: 1qey C: [45668] |
PDB Entry: 1qey (more details)
SCOPe Domain Sequences for d1qeyc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qeyc_ h.2.1.1 (C:) Tetramerization domain of the Mnt repressor {Salmonella bacteriophage P22 [TaxId: 10754]} rndaerladeqselvkkmvfdtlkdlykktt
Timeline for d1qeyc_: