SCOPe 2.07: Domain d1qeyb_: 1qey B:

Lineage for d1qeyb_ (1qey B:)

1. Root: SCOPe 2.07

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.2: Tetramerization domain of the Mnt repressor [58058] (1 superfamily)

4. Superfamily h.2.1: Tetramerization domain of the Mnt repressor [58059] (1 family)
   tetrameric antiparallel bundle with a right-handed twist

5. Family h.2.1.1: Tetramerization domain of the Mnt repressor [58060] (1 protein)

6. Protein Tetramerization domain of the Mnt repressor [58061] (1 species)

7. Species Salmonella bacteriophage P22 [TaxId:10754] [58062] (1 PDB entry)

8. Domain d1qeyb_: 1qey B: [45667]

Details for d1qeyb_

PDB Entry: 1qey

PDB Description: nmr structure determination of the tetramerization domain of the mnt repressor: an asymmetric a-helical assembly in slow exchange

PDB Compounds: (B:) protein (regulatory protein mnt)

SCOPe Domain Sequences for d1qeyb_:

Sequence; same for both SEQRES and ATOM records:

>d1qeyb_ h.2.1.1 (B:) Tetramerization domain of the Mnt repressor {Salmonella bacteriophage P22 [TaxId: 10754]}
rndaerladeqselvkkmvfdtlkdlykktt

Timeline for d1qeyb_:

• d1qeyb_ first appeared (with stable ids) in SCOP 1.55
  
• d1qeyb_ appears in SCOPe 2.06
  
• d1qeyb_ appears in the current release, SCOPe 2.08