Lineage for d1qeyb_ (1qey B:)

  1. Root: SCOP 1.61
  2. 205390Class h: Coiled coil proteins [57942] (5 folds)
  3. 205968Fold h.2: Tetramerization domain of the Mnt repressor [58058] (1 superfamily)
  4. 205969Superfamily h.2.1: Tetramerization domain of the Mnt repressor [58059] (1 family) (S)
  5. 205970Family h.2.1.1: Tetramerization domain of the Mnt repressor [58060] (1 protein)
  6. 205971Protein Tetramerization domain of the Mnt repressor [58061] (1 species)
  7. 205972Species Salmonella bacteriophage P22 [TaxId:10754] [58062] (1 PDB entry)
  8. 205974Domain d1qeyb_: 1qey B: [45667]

Details for d1qeyb_

PDB Entry: 1qey (more details)

PDB Description: nmr structure determination of the tetramerization domain of the mnt repressor: an asymmetric a-helical assembly in slow exchange

SCOP Domain Sequences for d1qeyb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qeyb_ h.2.1.1 (B:) Tetramerization domain of the Mnt repressor {Salmonella bacteriophage P22}
rndaerladeqselvkkmvfdtlkdlykktt

SCOP Domain Coordinates for d1qeyb_:

Click to download the PDB-style file with coordinates for d1qeyb_.
(The format of our PDB-style files is described here.)

Timeline for d1qeyb_: