| Class h: Coiled coil proteins [57942] (5 folds) |
| Fold h.2: Tetramerization domain of the Mnt repressor [58058] (1 superfamily) |
Superfamily h.2.1: Tetramerization domain of the Mnt repressor [58059] (1 family) ![]() |
| Family h.2.1.1: Tetramerization domain of the Mnt repressor [58060] (1 protein) |
| Protein Tetramerization domain of the Mnt repressor [58061] (1 species) |
| Species Salmonella bacteriophage P22 [TaxId:10754] [58062] (1 PDB entry) |
| Domain d1qeyb_: 1qey B: [45667] |
PDB Entry: 1qey (more details)
SCOP Domain Sequences for d1qeyb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qeyb_ h.2.1.1 (B:) Tetramerization domain of the Mnt repressor {Salmonella bacteriophage P22}
rndaerladeqselvkkmvfdtlkdlykktt
Timeline for d1qeyb_: