SCOPe 2.08: Domain d1qeya_: 1qey A:

Lineage for d1qeya_ (1qey A:)

1. Root: SCOPe 2.08

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.2: Tetramerization domain of the Mnt repressor [58058] (1 superfamily)

4. Superfamily h.2.1: Tetramerization domain of the Mnt repressor [58059] (1 family)
   tetrameric antiparallel bundle with a right-handed twist

5. Family h.2.1.1: Tetramerization domain of the Mnt repressor [58060] (1 protein)

6. Protein Tetramerization domain of the Mnt repressor [58061] (1 species)

7. Species Salmonella bacteriophage P22 [TaxId:10754] [58062] (1 PDB entry)

8. Domain d1qeya_: 1qey A: [45666]

Details for d1qeya_

PDB Entry: 1qey

PDB Description: nmr structure determination of the tetramerization domain of the mnt repressor: an asymmetric a-helical assembly in slow exchange

PDB Compounds: (A:) protein (regulatory protein mnt)

SCOPe Domain Sequences for d1qeya_:

Sequence; same for both SEQRES and ATOM records:

>d1qeya_ h.2.1.1 (A:) Tetramerization domain of the Mnt repressor {Salmonella bacteriophage P22 [TaxId: 10754]}
rndaerladeqselvkkmvfdtlkdlykktt

Timeline for d1qeya_:

• d1qeya_ first appeared (with stable ids) in SCOP 1.55
  
• d1qeya_ appears in SCOPe 2.07