Lineage for d1debb_ (1deb B:)

  1. Root: SCOP 1.55
  2. Class h: Coiled coil proteins [57942] (5 folds)
  3. Fold h.1: Parallel coiled-coil [57943] (19 superfamilies)
  4. Superfamily h.1.18: N-terminal coiled coil domain from apc [58050] (1 family) (S)
  5. Family h.1.18.1: N-terminal coiled coil domain from apc [58051] (1 protein)
  6. Protein N-terminal coiled coil domain from apc [58052] (1 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [58053] (1 PDB entry)
  8. Domain d1debb_: 1deb B: [45661]

Details for d1debb_

PDB Entry: 1deb (more details), 2.4 Å

PDB Description: crystal structure of the n-terminal coiled coil domain from apc
PDB Compounds: (B:) adenomatous polyposis coli protein

SCOP Domain Sequences for d1debb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1debb_ h.1.18.1 (B:) N-terminal coiled coil domain from apc {Human (Homo sapiens)}
aasydqllkqvealkmensnlrqelednsnhltkleteasnmkevlkqlqgsi

SCOP Domain Coordinates for d1debb_ are not available.

Timeline for d1debb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1deba_