Lineage for d1debb_ (1deb B:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3039231Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 3040406Superfamily h.1.18: N-terminal coiled coil domain from apc [58050] (1 family) (S)
  5. 3040407Family h.1.18.1: N-terminal coiled coil domain from apc [58051] (1 protein)
  6. 3040408Protein N-terminal coiled coil domain from apc [58052] (1 species)
  7. 3040409Species Human (Homo sapiens) [TaxId:9606] [58053] (1 PDB entry)
  8. 3040411Domain d1debb_: 1deb B: [45661]
    complexed with so4

Details for d1debb_

PDB Entry: 1deb (more details), 2.4 Å

PDB Description: crystal structure of the n-terminal coiled coil domain from apc
PDB Compounds: (B:) adenomatous polyposis coli protein

SCOPe Domain Sequences for d1debb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1debb_ h.1.18.1 (B:) N-terminal coiled coil domain from apc {Human (Homo sapiens) [TaxId: 9606]}
aasydqllkqvealkmensnlrqelednsnhltkleteasnmkevlkqlqgsi

SCOPe Domain Coordinates for d1debb_:

Click to download the PDB-style file with coordinates for d1debb_.
(The format of our PDB-style files is described here.)

Timeline for d1debb_: