Lineage for d1avyb_ (1avy B:)

  1. Root: SCOPe 2.07
  2. 2643820Class h: Coiled coil proteins [57942] (7 folds)
  3. 2643821Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 2644972Superfamily h.1.17: Fibritin [58046] (1 family) (S)
  5. 2644973Family h.1.17.1: Fibritin [58047] (1 protein)
  6. 2644974Protein Fibritin [58048] (2 species)
    biological unit: trimer; fragmented coiled coil capped with beta-hairpin triplet
  7. 2644975Species Bacteriophage T4 [TaxId:10665] [58049] (7 PDB entries)
    Uniprot P10104
  8. 2644991Domain d1avyb_: 1avy B: [45657]
    deletion mutant M
    mutant

Details for d1avyb_

PDB Entry: 1avy (more details), 1.85 Å

PDB Description: fibritin deletion mutant m (bacteriophage t4)
PDB Compounds: (B:) fibritin

SCOPe Domain Sequences for d1avyb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1avyb_ h.1.17.1 (B:) Fibritin {Bacteriophage T4 [TaxId: 10665]}
vrqevntakgnisslqgdvqalqeagyipeaprdgqayvrkdgewvllstflsp

SCOPe Domain Coordinates for d1avyb_:

Click to download the PDB-style file with coordinates for d1avyb_.
(The format of our PDB-style files is described here.)

Timeline for d1avyb_: