Lineage for d1eq7a_ (1eq7 A:)

  1. Root: SCOPe 2.06
  2. 2265466Class h: Coiled coil proteins [57942] (7 folds)
  3. 2265467Fold h.1: Parallel coiled-coil [57943] (38 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 2266531Superfamily h.1.16: Outer membrane lipoprotein [58042] (1 family) (S)
  5. 2266532Family h.1.16.1: Outer membrane lipoprotein [58043] (1 protein)
  6. 2266533Protein Outer membrane lipoprotein [58044] (1 species)
    forms trimer
  7. 2266534Species Escherichia coli [TaxId:562] [58045] (8 PDB entries)
    Uniprot P69776 25-74
  8. 2266548Domain d1eq7a_: 1eq7 A: [45655]

Details for d1eq7a_

PDB Entry: 1eq7 (more details), 1.9 Å

PDB Description: core structure of the outer membrane lipoprotein from escherichia coli at 1.9 angstrom resolution
PDB Compounds: (A:) outer membrane lipoprotein

SCOPe Domain Sequences for d1eq7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eq7a_ h.1.16.1 (A:) Outer membrane lipoprotein {Escherichia coli [TaxId: 562]}
ssnakidqlssdvqtlnakvdqlsndvnamrsdvqaakddaaranqrldnmatkyr

SCOPe Domain Coordinates for d1eq7a_:

Click to download the PDB-style file with coordinates for d1eq7a_.
(The format of our PDB-style files is described here.)

Timeline for d1eq7a_: