Lineage for d1eq7a_ (1eq7 A:)

  1. Root: SCOP 1.55
  2. Class h: Coiled coil proteins [57942] (5 folds)
  3. Fold h.1: Parallel coiled-coil [57943] (19 superfamilies)
  4. Superfamily h.1.16: Outer membrane lipoprotein [58042] (1 family) (S)
  5. Family h.1.16.1: Outer membrane lipoprotein [58043] (1 protein)
  6. Protein Outer membrane lipoprotein [58044] (1 species)
  7. Species Escherichia coli [TaxId:562] [58045] (1 PDB entry)
  8. Domain d1eq7a_: 1eq7 A: [45655]

Details for d1eq7a_

PDB Entry: 1eq7 (more details), 1.9 Å

PDB Description: core structure of the outer membrane lipoprotein from escherichia coli at 1.9 angstrom resolution
PDB Compounds: (A:) outer membrane lipoprotein

SCOP Domain Sequences for d1eq7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eq7a_ h.1.16.1 (A:) Outer membrane lipoprotein {Escherichia coli}
ssnakidqlssdvqtlnakvdqlsndvnamrsdvqaakddaaranqrldnmatkyr

SCOP Domain Coordinates for d1eq7a_ are not available.

Timeline for d1eq7a_: