Lineage for d1sfcb_ (1sfc B:)

  1. Root: SCOPe 2.06
  2. 2265466Class h: Coiled coil proteins [57942] (7 folds)
  3. 2265467Fold h.1: Parallel coiled-coil [57943] (38 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 2266412Superfamily h.1.15: SNARE fusion complex [58038] (2 families) (S)
    tetrameric parallel coiled coil
  5. 2266413Family h.1.15.1: SNARE fusion complex [58039] (12 proteins)
  6. 2266482Protein Syntaxin 1A [88908] (3 species)
  7. 2266489Species Norway rat (Rattus norvegicus) [TaxId:10116] [88909] (6 PDB entries)
    Uniprot P32851 196-259
    a globular structure of a larger fragment containing this region is available; seepdb:1dn1, chain B
  8. 2266499Domain d1sfcb_: 1sfc B: [45644]
    Other proteins in same PDB: d1sfca_, d1sfcc_, d1sfcd_, d1sfce_, d1sfcg_, d1sfch_, d1sfci_, d1sfck_, d1sfcl_
    complex with synaptobrevin and SNAP-25 fragments
    complexed with mpd, sr

Details for d1sfcb_

PDB Entry: 1sfc (more details), 2.4 Å

PDB Description: neuronal synaptic fusion complex
PDB Compounds: (B:) protein (syntaxin 1a)

SCOPe Domain Sequences for d1sfcb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sfcb_ h.1.15.1 (B:) Syntaxin 1A {Norway rat (Rattus norvegicus) [TaxId: 10116]}
skqalseietrhseiiklensirelhdmfmdmamlvesqgemidrieynvehavdyvera
vsdtkkavkyqs

SCOPe Domain Coordinates for d1sfcb_:

Click to download the PDB-style file with coordinates for d1sfcb_.
(The format of our PDB-style files is described here.)

Timeline for d1sfcb_: