Lineage for d1ezja_ (1ezj A:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3039231Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 3040214Superfamily h.1.14: Multimerization domain of the phosphoprotein from sendai virus [58034] (1 family) (S)
  5. 3040215Family h.1.14.1: Multimerization domain of the phosphoprotein from sendai virus [58035] (1 protein)
  6. 3040216Protein Multimerization domain of the phosphoprotein from sendai virus [58036] (1 species)
  7. 3040217Species Sendai virus [TaxId:11191] [58037] (1 PDB entry)
  8. 3040218Domain d1ezja_: 1ezj A: [45638]
    complexed with ca, emc

Details for d1ezja_

PDB Entry: 1ezj (more details), 1.9 Å

PDB Description: crystal structure of the multimerization domain of the phosphoprotein from sendai virus
PDB Compounds: (A:) nucleocapsid phosphoprotein

SCOPe Domain Sequences for d1ezja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ezja_ h.1.14.1 (A:) Multimerization domain of the phosphoprotein from sendai virus {Sendai virus [TaxId: 11191]}
entssmkematlltslgviqsaqefessrdasyvfarralksanyaemtfnvcglilsae
kssarkvdenkqllkqiqesvesfrdiykrfseyqkeqnsllmsnlstlhiitd

SCOPe Domain Coordinates for d1ezja_:

Click to download the PDB-style file with coordinates for d1ezja_.
(The format of our PDB-style files is described here.)

Timeline for d1ezja_: