SCOP 1.73: Domain d1dkgb2: 1dkg B:38-138

Lineage for d1dkgb2 (1dkg B:38-138)

1. Root: SCOP 1.73

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (33 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.9: Coiled-coil domain of nucleotide exchange factor GrpE [58014] (1 family)

5. Family h.1.9.1: Coiled-coil domain of nucleotide exchange factor GrpE [58015] (1 protein)

6. Protein Coiled-coil domain of nucleotide exchange factor GrpE [58016] (1 species)

7. Species Escherichia coli [TaxId:562] [58017] (1 PDB entry)

8. Domain d1dkgb2: 1dkg B:38-138 [45627]
   Other proteins in same PDB: d1dkga1, d1dkgb1, d1dkgd1, d1dkgd2
   mutant

Details for d1dkgb2

PDB Entry: 1dkg, 2.8 Å

PDB Description: crystal structure of the nucleotide exchange factor grpe bound to the atpase domain of the molecular chaperone dnak

PDB Compounds: (B:) nucleotide exchange factor grpe

SCOP Domain Sequences for d1dkgb2:

Sequence, based on SEQRES records:

>d1dkgb2 h.1.9.1 (B:38-138) Coiled-coil domain of nucleotide exchange factor GrpE {Escherichia coli [TaxId: 562]}
dprdekvanleaqlaeaqtrerdgilrvkaemenlrrrteldiekahkfalekfinellp
vidsldralevadkanpdmsamvedieltlksmldvvrkfg

Sequence, based on observed residues (ATOM records):

>d1dkgb2 h.1.9.1 (B:38-138) Coiled-coil domain of nucleotide exchange factor GrpE {Escherichia coli [TaxId: 562]}
dprdekvanleaqlaeaqtrerdgilrvkaemenlrrrteldiekahkfalekfinellp
vidsldralevmsamvedieltlksmldvvrkfg

Timeline for d1dkgb2:

• d1dkgb2 first appeared (with stable ids) in SCOP 1.55
  
• d1dkgb2 appears in SCOP 1.71
  
• d1dkgb2 appears in SCOP 1.75
  
• d1dkgb2 appears in the current release, SCOPe 2.08