Lineage for d1dkgb2 (1dkg B:38-138)

  1. Root: SCOP 1.73
  2. 752207Class h: Coiled coil proteins [57942] (7 folds)
  3. 752208Fold h.1: Parallel coiled-coil [57943] (33 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 752892Superfamily h.1.9: Coiled-coil domain of nucleotide exchange factor GrpE [58014] (1 family) (S)
  5. 752893Family h.1.9.1: Coiled-coil domain of nucleotide exchange factor GrpE [58015] (1 protein)
  6. 752894Protein Coiled-coil domain of nucleotide exchange factor GrpE [58016] (1 species)
  7. 752895Species Escherichia coli [TaxId:562] [58017] (1 PDB entry)
  8. 752897Domain d1dkgb2: 1dkg B:38-138 [45627]
    Other proteins in same PDB: d1dkga1, d1dkgb1, d1dkgd1, d1dkgd2
    mutant

Details for d1dkgb2

PDB Entry: 1dkg (more details), 2.8 Å

PDB Description: crystal structure of the nucleotide exchange factor grpe bound to the atpase domain of the molecular chaperone dnak
PDB Compounds: (B:) nucleotide exchange factor grpe

SCOP Domain Sequences for d1dkgb2:

Sequence, based on SEQRES records: (download)

>d1dkgb2 h.1.9.1 (B:38-138) Coiled-coil domain of nucleotide exchange factor GrpE {Escherichia coli [TaxId: 562]}
dprdekvanleaqlaeaqtrerdgilrvkaemenlrrrteldiekahkfalekfinellp
vidsldralevadkanpdmsamvedieltlksmldvvrkfg

Sequence, based on observed residues (ATOM records): (download)

>d1dkgb2 h.1.9.1 (B:38-138) Coiled-coil domain of nucleotide exchange factor GrpE {Escherichia coli [TaxId: 562]}
dprdekvanleaqlaeaqtrerdgilrvkaemenlrrrteldiekahkfalekfinellp
vidsldralevmsamvedieltlksmldvvrkfg

SCOP Domain Coordinates for d1dkgb2:

Click to download the PDB-style file with coordinates for d1dkgb2.
(The format of our PDB-style files is described here.)

Timeline for d1dkgb2: